KEGG   Streptomyces liangshanensis: HA039_05735
Entry
HA039_05735       CDS       T07519                                 
Name
(GenBank) cyclase
  KO
K15885  C7-C12 aromatase (ARO/CYC) [EC:4.2.1.-]
Organism
slia  Streptomyces liangshanensis
Pathway
slia01056  Biosynthesis of type II polyketide backbone
slia01100  Metabolic pathways
slia01110  Biosynthesis of secondary metabolites
Module
slia_M00778  Type II polyketide backbone biosynthesis, acyl-CoA + malonyl-CoA => polyketide
Brite
KEGG Orthology (KO) [BR:slia00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01056 Biosynthesis of type II polyketide backbone
    HA039_05735
Enzymes [BR:slia01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.-
     HA039_05735
SSDB
Motif
Pfam: Polyketide_cyc2 Polyketide_cyc
Other DBs
NCBI-ProteinID: QIQ01855
UniProt: A0A6G9GUF9
LinkDB
Position
complement(1308669..1309598)
AA seq 309 aa
MSNIEVTHRIDVSASAESVHRIVADVGLWPLYFPPTVRAERVSGDDTDERIRIWAVANGR
LRTWESRRITDGRRVRFEQIRPSAPVAALGGEWSVEERGSGRCAVVLDHHYRAVDDDPVQ
LDLIARAVEHNSVSELAHLKRAAERGESEKELLLDFEDTEIIAGSLEDTYDFLYDVGKWP
ERVPHVARIELREDTPGLQHMEMDTISPDGSLHTTVSGRVCDPSRRIVYKQTKLPPVLQA
HNGEWTFESTQDGSVRVTSRHQVILDPDGIAALPEPPASLDAAKAAVRHALGSNSRATLA
RARQFVESR
NT seq 930 nt   +upstreamnt  +downstreamnt
atgagcaacatcgaggtgacccaccggatcgacgtgtcggcgtccgcggagtcggtgcac
cgcatcgtcgccgacgtcggcctgtggccgctgtacttcccgccgacggtacgggccgag
cgtgtgtcgggcgacgacaccgacgagcggatccggatctgggccgtcgccaacggccgg
ctgcgcacctgggagtcgaggcggatcacggacggccgccgggtgcggttcgagcagatc
cggccctccgccccggtggccgcgctgggcggcgagtggtccgtggaggagcggggcagc
ggccggtgcgccgtggtcctcgaccaccactaccgcgccgtcgacgacgacccggtgcaa
ctcgacctgatcgcccgggcggtggaacacaacagcgtctcggaactcgcccacctcaag
cgcgccgccgaacgaggcgagagcgagaaggagttgctcctcgacttcgaggacaccgag
atcatcgccggttcgctggaggacacctacgacttcctctacgacgtggggaaatggccc
gagcgggtgccccacgtcgcccgtatcgagctgcgcgaggacaccccgggactccagcac
atggagatggacacgatctcaccggacggctcgctgcacaccacggtgtccggccgggtg
tgtgacccctcgcgacggatcgtctacaagcagacgaagctgccgcccgtgctccaggcg
cacaacggcgagtggacgttcgagtccacccaggacggttccgtccgggtcacgtcccgg
caccaggtgatcctggacccggacgggatcgccgcgctgcccgagccgcccgcgtcgctc
gacgcggccaaggccgccgtccggcacgccctgggctccaacagccgggccaccctggcc
agggcgcgccagttcgtcgaatcacgctga

DBGET integrated database retrieval system