Streptomyces liangshanensis: HA039_14015 Help Entry HA039_14015       CDS       T07519                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism slia  Streptomyces liangshanensis Pathway slia00998   Biosynthesis of various antibiotics slia01100   Metabolic pathways slia01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:slia00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     HA039_14015    00074 Mycolic acid biosynthesis     HA039_14015   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     HA039_14015 SSDB OrthologParalogGFIT Motif Pfam:  PP-binding LEF-4 Motif Other DBs NCBI-ProteinID:  QIQ03302 UniProt:  A0A6G9GYE4 LinkDB All DBs Position 3260192..3260473 Genome browser AA seq 93 aa AA seqDB search MSQKAVTLSSDEILARVRVIVAEELELEDEPAAVDPSARFVEDFDADSLALIQILARIDK ELTISVPVEEAENLVDLRTLADHVIALAGAERV NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atgtctcagaaggctgtgacgctgtcgtccgacgaaatcctcgcgcgggtccgggtcatc gtcgcggaggagctggagctggaggacgagccggcggccgtcgacccgtccgcgcgcttc gtcgaggacttcgacgcggactcgctggcactgatccagatcctcgcccggatcgacaag gaactgacgatatccgtgccggtcgaggaggccgagaacctcgtcgacctgcggaccctc gcggaccacgtcatcgcgctcgccggggccgagcgtgtctga

DBGET integrated database retrieval system