Streptomyces liangshanensis: HA039_18555 Help Entry HA039_18555       CDS       T07519                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism slia  Streptomyces liangshanensis Pathway slia00998   Biosynthesis of various antibiotics slia01100   Metabolic pathways slia01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:slia00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     HA039_18555    00074 Mycolic acid biosynthesis     HA039_18555   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     HA039_18555 SSDB OrthologParalogGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QIQ04048 UniProt:  A0A6G9H0J3 LinkDB All DBs Position 4299763..4299993 Genome browser AA seq 76 aa AA seqDB search MFEQFKSLLVDKLKVAPDLITPEATREDIELDSLDVVELSLMLNSELGLTISDDELLEAA TVGDMVALMEERGAKI NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atgttcgagcaattcaagagcctcctcgtcgacaagctgaaggtcgcgcccgacctgatc acgcccgaggccacccgggaggacatcgaactcgactccctcgacgtcgtggagctgtcc ctgatgctcaactccgagctgggcctcaccatcagcgacgacgaactgctggaggcggcc accgtcggcgacatggtggcgctcatggaggagcgaggcgcgaagatctga

DBGET integrated database retrieval system