Sulfuricaulis limicola: SCL_1371 Help Entry SCL_1371          CDS       T05241                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism slim  Sulfuricaulis limicola Pathway slim01100   Metabolic pathways slim01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:slim00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     SCL_1371    00074 Mycolic acid biosynthesis     SCL_1371   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     SCL_1371 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 TerB HLH Ribosomal_L50 DUF5783 Motif Other DBs NCBI-ProteinID:  BAV33682 UniProt:  A0A1B4XFV3 LinkDB All DBs Position 1376234..1376470 Genome browser AA seq 78 aa AA seqDB search MSSVEERVKKIVVEQLGVNEGEVKPAASFVDDLGADSLDTVELVMALEEEFDCEIPDDQA EKITTVQQAIDYINSRLN NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcagtgtcgaagagcgcgtcaagaagattgtcgtggagcagttgggcgttaacgag ggcgaggtcaagcctgccgcctccttcgtggatgatttgggcgcggattccctggatacg gtcgagctggtaatggcgctggaagaggaatttgactgtgaaattcccgatgaccaggcg gagaaaatcaccaccgtccagcaggccatcgactacatcaactcccgtctgaactga

DBGET integrated database retrieval system