Sulfuricaulis limicola: SCL_1475 Help Entry SCL_1475          CDS       T05241                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism slim  Sulfuricaulis limicola Pathway slim01100   Metabolic pathways slim01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:slim00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     SCL_1475    00074 Mycolic acid biosynthesis     SCL_1475   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     SCL_1475 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 DUF1493 Motif Other DBs NCBI-ProteinID:  BAV33783 UniProt:  A0A1B4XG60 LinkDB All DBs Position complement(1481198..1481452) Genome browser AA seq 84 aa AA seqDB search MNVNVQQRVFKVFSEVLNRKETEIQPELSLRDDLQLDSLQQMTLFIALEDEFEHSLPPEE VTGLVTVKDIVSFIDRKLQETASA NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgaacgtcaatgtgcagcagcgagtattcaaggttttttctgaagtattgaatcggaaa gaaaccgaaattcagccggaattatcgctccgtgacgacctacagctggactccctccag caaatgacgttgttcattgccctggaagacgagtttgaacacagcctgccaccggaagag gtgacggggcttgtcaccgtcaaggacatcgtctccttcatagacaggaaactccaagaa accgcttccgcatga

DBGET integrated database retrieval system