Spodoptera litura (tobacco cutworm): 111352557 Help Entry 111352557         CDS       T08157                                  Name (RefSeq) ras-related protein Rab-7a   KO K07897   Ras-related protein Rab-7A Organism sliu  Spodoptera litura (tobacco cutworm) Pathway sliu04137   Mitophagy - animal sliu04140   Autophagy - animal sliu04144   Endocytosis sliu04145   Phagosome sliu04148   Efferocytosis Brite KEGG Orthology (KO) [BR:sliu00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     111352557    04145 Phagosome     111352557    04140 Autophagy - animal     111352557    04137 Mitophagy - animal     111352557    04148 Efferocytosis     111352557  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:sliu04131]     111352557   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:sliu04147]     111352557    04031 GTP-binding proteins [BR:sliu04031]     111352557 Membrane trafficking [BR:sliu04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     111352557 Exosome [BR:sliu04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    111352557   Exosomal proteins of other body fluids (saliva and urine)    111352557   Exosomal proteins of colorectal cancer cells    111352557   Exosomal proteins of bladder cancer cells    111352557 GTP-binding proteins [BR:sliu04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     111352557 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU Gtr1_RagA RsgA_GTPase ATP_bind_1 cobW nSTAND3 AAA_16 Septin PduV-EutP AAA_24 AAA_22 NACHT AAA_7 G-alpha ATPase_2 AAA_5 NTPase_1 SRPRB ABC_tran DAP3 AAA_14 TniB NB-ARC ATP-synt_ab RNA_helicase PRK RuvB_N Motif Other DBs NCBI-GeneID:  111352557 NCBI-ProteinID:  XP_022820883 UniProt:  A0A9J7IMV2 LinkDB All DBs Position 2:complement(5740450..5743107) Genome browser AA seq 208 aa AA seqDB search MSSRKKALLKVIILGDSGVGKTSLMNQFVNKKFSNQYKATIGADFLTKEVIVDDRIVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKSLESWRDEFLIQASPRDPDNFPF VILGNKIDLDNRAVSAKRAQQWCQSKNDIPYFETSAKEAVNVELAFQTIARNALAQETEA ELYNEFPDQIKLNANDNGRNRDGDNCAC NT seq 627 nt NT seq  +upstreamnt  +downstreamnt atgtcgtcgagaaaaaaggcacttctgaaggtaattatccttggcgatagcggtgtaggc aaaacttcgcttatgaatcagtttgtcaacaagaaattttccaaccagtacaaggcaaca ataggcgcagattttctcacgaaagaggtaatcgtagatgatcgaatcgtcacaatgcag atttgggatactgctggccaggaacgattccaatctttaggagtggcgttctatcgcggg gcggattgttgcgtcttagtatttgacgtaactgcccccaacacgttcaagtccttggaa agttggagggacgaatttttgatacaagcttcaccaagggatcctgacaacttcccgttt gtcattttgggcaacaagattgacctggacaatcgcgctgtttctgctaagcgggcacaa caatggtgtcaaagtaaaaatgatattccctattttgaaacgagtgccaaagaggctgtg aatgtggagcttgcattccagaccatagctcggaatgctttggcccaggagacagaagca gagctgtacaacgagtttcctgatcaaatcaagcttaatgccaatgacaatggtcgtaac agggatggtgacaactgtgcttgctag

DBGET integrated database retrieval system