Spodoptera litura (tobacco cutworm): 111355955 Help Entry 111355955         CDS       T08157                                  Name (RefSeq) elongin-B   KO K03873   elongin-B Organism sliu  Spodoptera litura (tobacco cutworm) Pathway sliu04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:sliu00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     111355955  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:sliu04121]     111355955    03400 DNA repair and recombination proteins [BR:sliu03400]     111355955 Ubiquitin system [BR:sliu04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      111355955    Cul5 complex      111355955 DNA repair and recombination proteins [BR:sliu03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      111355955 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Rad60-SLD Motif Other DBs NCBI-GeneID:  111355955 NCBI-ProteinID:  XP_022825884 UniProt:  A0A9J7IU47 LinkDB All DBs Position 22:complement(1864010..1876855) Genome browser AA seq 119 aa AA seqDB search MDVFLMIRRKKLTIFTDAKDTTTVLELKKMIEGILKVTPQSQMLFNKDSQLMDDEKTLAE YGLTSATAKAQSPAPIGLALRKENGEFEPLDLTPYSSPPDLPDVMKSQETNGQEQMDQH NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atggatgtctttctcatgattaggcgaaaaaaattaaccatcttcactgacgcgaaggac acgacaacggttttagaactgaagaaaatgatagaaggtatcttgaaagtgacaccacaa agtcagatgctgttcaacaaggacagtcagctgatggacgatgagaagaccctggctgaa tatggcctgacatcggctacggccaaggcccaaagtcctgcaccaattggattggcttta aggaaggaaaatggcgagtttgaaccactggatctgactccttactcttctccaccggac ctgcccgacgtgatgaagtcacaggagaccaatggccaggaacaaatggatcaacactaa

DBGET integrated database retrieval system