Spodoptera litura (tobacco cutworm): 111358043 Help Entry 111358043         CDS       T08157                                  Name (RefSeq) DNA polymerase epsilon subunit 3   KO K02326   DNA polymerase epsilon subunit 3 [EC:2.7.7.7] Organism sliu  Spodoptera litura (tobacco cutworm) Pathway sliu03030   DNA replication sliu03082   ATP-dependent chromatin remodeling sliu03410   Base excision repair sliu03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:sliu00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     111358043    03410 Base excision repair     111358043    03420 Nucleotide excision repair     111358043   09126 Chromosome    03082 ATP-dependent chromatin remodeling     111358043  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:sliu03032]     111358043    03036 Chromosome and associated proteins [BR:sliu03036]     111358043    03400 DNA repair and recombination proteins [BR:sliu03400]     111358043 Enzymes [BR:sliu01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.7  Nucleotidyltransferases     2.7.7.7  DNA-directed DNA polymerase      111358043 DNA replication proteins [BR:sliu03032]  Eukaryotic type   DNA Replication Elongation Factors    DNA polymerase epsilon complex     111358043 Chromosome and associated proteins [BR:sliu03036]  Eukaryotic type   Chromatin remodeling factors    CHRAC complex     111358043 DNA repair and recombination proteins [BR:sliu03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Long Patch-BER factors      DNA polymerase epsilon complex       111358043 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CBFD_NFYB_HMF Histone TAF Ipi1_N Motif Other DBs NCBI-GeneID:  111358043 NCBI-ProteinID:  XP_022828695 UniProt:  A0A9J7IZA1 LinkDB All DBs Position 26:2239015..2239531 Genome browser AA seq 119 aa AA seqDB search MAEKLEDLNLPMTVVTRIVKEALPEGVSISKEARTGLAKAASVFVLYVTSAATNIVKNKK RKALTGQDVLDAMRDIEFDRFVEPLGEALEQYKQMVSARKSGGGKKKDEGEEVEMIEDD NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atggctgaaaaactcgaggacctgaatctcccgatgactgttgtgacgaggatagtgaaa gaagcactaccagagggcgtttcaatatcaaaggaggcgcgaaccggtctcgcgaaagcc gcatcagtttttgtgctttacgtgacttctgcagctacaaatatagtgaaaaataagaaa aggaaggctttgacgggtcaggatgtgttagacgctatgagggatatagaattcgacaga tttgttgagccgcttggcgaagctttagaacaatacaaacagatggtgtccgcacggaaa tctggtggtggcaagaagaaggatgaaggagaggaggtggaaatgatagaggatgactga

DBGET integrated database retrieval system