Spodoptera litura (tobacco cutworm): 111359294 Help Entry 111359294         CDS       T08157                                  Name (RefSeq) ras-related protein Rac1   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism sliu  Spodoptera litura (tobacco cutworm) Pathway sliu04013   MAPK signaling pathway - fly sliu04145   Phagosome sliu04148   Efferocytosis sliu04310   Wnt signaling pathway sliu04620   Toll-like receptor signaling pathway sliu05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:sliu00001]  09130 Environmental Information Processing   09132 Signal transduction    04013 MAPK signaling pathway - fly     111359294    04310 Wnt signaling pathway     111359294  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     111359294    04148 Efferocytosis     111359294  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     111359294  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     111359294  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:sliu04131]     111359294   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:sliu04147]     111359294    04031 GTP-binding proteins [BR:sliu04031]     111359294 Membrane trafficking [BR:sliu04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     111359294  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     111359294   Macropinocytosis    Ras GTPases     111359294  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     111359294 Exosome [BR:sliu04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    111359294   Exosomal proteins of other body fluids (saliva and urine)    111359294   Exosomal proteins of colorectal cancer cells    111359294   Exosomal proteins of bladder cancer cells    111359294 GTP-binding proteins [BR:sliu04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     111359294 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU CagD Motif Other DBs NCBI-GeneID:  111359294 NCBI-ProteinID:  XP_022830536 UniProt:  A0A059VBV6 LinkDB All DBs Position 29:4188322..4218162 Genome browser AA seq 192 aa AA seqDB search MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPINLGLWDTAG QEDYDRLRPLSYPQTDVFLICFSLVNPASFENVRAKWFPEVRHHCPSTPIILVGTKLDLR EDKDTIEKLKDKKLAPITYTQGLGMSKEISAVKYLECSALTQKGLKTVFDEAIRAVLCPV QPIKPRRKCRLL NT seq 579 nt NT seq  +upstreamnt  +downstreamnt atgcaggcgattaaatgtgtagtggtcggtgacggagccgtcggtaaaacatgtctacta atcagttacaccacaaatgccttcccaggagagtacatacctacagtattcgacaactat tcagcgaatgtgatggtggacggcaaacccatcaacctgggactatgggatacggcggga caggaagactacgacagactgcgacctctctcctacccacagacagacgtcttccttata tgcttctcgcttgttaacccagcatcattcgaaaacgtgcgagctaagtggttccccgaa gtccggcatcactgcccgtcgacgcccatcatcctggtcggcaccaagctggatcttcgc gaagacaaggacaccattgagaagctgaaggacaagaaactcgctcccatcacctacaca cagggtctgggcatgtctaaagagatcagcgcagtgaagtacctggaatgctcggcgctg acacagaaggggctgaagacggtgttcgacgaggccatccgcgccgtgctctgtcccgtg cagcccatcaagccgaggcggaagtgtagactgctctaa

DBGET integrated database retrieval system