Spodoptera litura (tobacco cutworm): 111359528 Help Entry 111359528         CDS       T08157                                  Name (RefSeq) autophagy protein 12-like   KO K08336   ubiquitin-like protein ATG12 Organism sliu  Spodoptera litura (tobacco cutworm) Pathway sliu04068   FoxO signaling pathway sliu04136   Autophagy - other sliu04140   Autophagy - animal Brite KEGG Orthology (KO) [BR:sliu00001]  09130 Environmental Information Processing   09132 Signal transduction    04068 FoxO signaling pathway     111359528  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     111359528    04136 Autophagy - other     111359528  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:sliu04131]     111359528    04121 Ubiquitin system [BR:sliu04121]     111359528    03029 Mitochondrial biogenesis [BR:sliu03029]     111359528 Membrane trafficking [BR:sliu04131]  Autophagy   Autophagosome formation proteins    Atg12 conjugation proteins     111359528 Ubiquitin system [BR:sliu04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitin-like proteins (UBLs)    111359528 Mitochondrial biogenesis [BR:sliu03029]  Mitochondrial quality control factors   Mitophagy factors    Autophagy-related proteins     111359528 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  APG12 ATG8 Motif Other DBs NCBI-GeneID:  111359528 NCBI-ProteinID:  XP_022830879 UniProt:  A0A9J7IZ85 LinkDB All DBs Position 29:527335..529410 Genome browser AA seq 127 aa AA seqDB search MGDDKQASDVQSDLSQATESLKIESEQKDNGDSSKGDNKVKIDILLKATGNAPIMKKKKW AVDAEKPIGWIMEFVKKYLKLEPNEKLFLYVNQTFAPSPDQLVKNLYECFGTDGKLVLHY CKSQAWG NT seq 384 nt NT seq  +upstreamnt  +downstreamnt atgggtgatgacaagcaagccagcgatgttcaatcagatctatctcaagcgactgagagt ttaaaaattgagagtgagcaaaaagataatggagactcttcgaaaggagacaacaaagtt aaaattgacatcttgttgaaagccacaggaaatgcacccattatgaagaaaaagaaatgg gctgttgatgcagagaaaccaattggttggatcatggaatttgtgaagaaatatcttaaa ttagagcctaatgagaaattgtttctgtatgtgaaccagacatttgctccatctccggac caattagtgaagaacttatatgagtgttttggtactgatggtaaactggtgttgcattac tgtaagagtcaagcttggggctga

DBGET integrated database retrieval system