Shewanella livingstonensis: EGC82_20720 Help Entry EGC82_20720       CDS       T05875                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism slj  Shewanella livingstonensis Pathway slj01100   Metabolic pathways slj01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:slj00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     EGC82_20720    00074 Mycolic acid biosynthesis     EGC82_20720   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     EGC82_20720 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  AZG74963 UniProt:  A0A3G8LYX4 LinkDB All DBs Position 4737312..4737560 Genome browser AA seq 82 aa AA seqDB search MQNREQILEMLSAILVEDFEIDATDITLEATLYEDLDLDSIDAVDLVIKLQQQTGKKIQP EAFKTVRTVDDVVNAIEGLIKS NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgcaaaatcgtgaacaaattctcgaaatgcttagcgctattttagttgaagattttgaa atagatgccacagatatcaccctagaagccactttgtatgaagatctggatttagacagt attgatgcggttgatttagtgattaaactacaacagcaaacgggtaaaaaaattcaacct gaagcctttaaaaccgtgcgcacagttgatgatgtcgtcaatgccattgaagggttaatt aaaagctaa

DBGET integrated database retrieval system