Streptomyces lunaelactis: SLUN_03075 Help Entry SLUN_03075        CDS       T06347                                  Name (GenBank) hypothetical protein   KO K02503   histidine triad (HIT) family protein [EC:3.9.1.-] Organism slk  Streptomyces lunaelactis Brite KEGG Orthology (KO) [BR:slk00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03016 Transfer RNA biogenesis [BR:slk03016]     SLUN_03075   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:slk04147]     SLUN_03075 Transfer RNA biogenesis [BR:slk03016]  Eukaryotic type   Aminoacyl-tRNA synthetases (AARSs)    AARS associated factors     SLUN_03075 Exosome [BR:slk04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    SLUN_03075 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cdc6_lid Motif Other DBs NCBI-ProteinID:  AVZ71357 UniProt:  A0A2R4SWX4 LinkDB All DBs Position complement(686603..686899) Genome browser AA seq 98 aa AA seqDB search MRPFSAGALELLTIAGELARSRNAAVCSSKDLAIAVVVYRKLLVNREFEPVQQPSLSPEM LGFDTSVERLVMGNGELEVAELVALAASENPDLAEYLE NT seq 297 nt NT seq  +upstreamnt  +downstreamnt gtgcggccattctccgccggtgcactcgaactcttgaccatcgccggtgagctcgcgcgt agccgcaatgcggcggtgtgttcgtcgaaggatctggctatcgctgtggtggtctaccgc aagctgctggtgaaccgcgagttcgagccggtgcagcagccgagtctgtccccggaaatg ctgggtttcgacacttcggtggagcggctggtaatggggaacggagaactcgaggtggca gaactggtcgccctggcggcttcagagaatccggatctggcggaatatctcgagtga

DBGET integrated database retrieval system