Stenotrophomonas sp. LM091: BIZ42_08860 Help Entry BIZ42_08860       CDS       T04630                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism slm  Stenotrophomonas sp. LM091 Pathway slm01100   Metabolic pathways slm01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:slm00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     BIZ42_08860    00074 Mycolic acid biosynthesis     BIZ42_08860   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     BIZ42_08860 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AOX62310 LinkDB All DBs Position complement(2029231..2029491) Genome browser AA seq 86 aa AA seqDB search MQALEHEIKELIISSLSLEDITPEDIDSAAPLFVEGLGLDSIDALELGLALQKKYGVSLS ADSEETRRHFSSVRALSEFVAARQPS NT seq 261 nt NT seq  +upstreamnt  +downstreamnt gtgcaggcacttgagcacgagatcaaggaattgatcatttcatcgctttcactggaagac atcactcccgaagacatcgattccgccgcccccctgtttgtcgaggggctgggcctggat tcgatcgacgcgctggaacttggattggccctgcagaaaaagtacggtgtcagcctgtca gccgattcggaagagacccgtcgccatttctccagcgtgcgtgccctgagcgagtttgtc gccgcacgccagccgtcctaa

DBGET integrated database retrieval system