Salipaludibacillus sp. LMS25: MM221_00590 Help Entry MM221_00590       CDS       T08296                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism slms  Salipaludibacillus sp. LMS25 Pathway slms00998   Biosynthesis of various antibiotics slms01100   Metabolic pathways slms01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:slms00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     MM221_00590 (acpP)    00074 Mycolic acid biosynthesis     MM221_00590 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     MM221_00590 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 PP-binding_2 Guanylate_cyc Motif Other DBs NCBI-ProteinID:  UTR15133 LinkDB All DBs Position complement(119912..120145) Genome browser AA seq 77 aa AA seqDB search MAAVQERIAKIVSERLGVDESEVKKEATFKDDLGADSLDVVELVMELEDEFDLEISDEDA EKIATVGDVIEYIERHQ NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atggcagcggtacaagaaagaattgcaaaaatcgtttccgaacgcctcggggtcgatgaa tcagaagtgaagaaagaagcgactttcaaggatgaccttggagctgactctttagacgtc gtcgaattagtgatggaacttgaagatgagtttgatcttgaaatttcagacgaagatgcg gagaaaattgcaacagtcggtgacgtgattgaatacatagagcgtcatcaataa

DBGET integrated database retrieval system