KEGG   Salipaludibacillus sp. LMS25: MM221_09550
Entry
MM221_09550       CDS       T08296                                 
Symbol
rplR
Name
(GenBank) 50S ribosomal protein L18
  KO
K02881  large subunit ribosomal protein L18
Organism
slms  Salipaludibacillus sp. LMS25
Pathway
slms03010  Ribosome
Brite
KEGG Orthology (KO) [BR:slms00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    MM221_09550 (rplR)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:slms03011]
    MM221_09550 (rplR)
Ribosome [BR:slms03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    MM221_09550 (rplR)
  Bacteria
    MM221_09550 (rplR)
  Archaea
    MM221_09550 (rplR)
SSDB
Motif
Pfam: Ribosomal_L18p DevR
Other DBs
NCBI-ProteinID: UTR16730
LinkDB
Position
2062943..2063305
AA seq 120 aa
MISKTDKNAVRKKRHAHVRRTITGTAERPRLNVFRSNKHIYAQLIDDVAGATLASASSLD
KELNIENGGNKQAAQQVGELVAKRALEKGHETVVFDRGGYLYHGRVQELADAAREAGLKF
NT seq 363 nt   +upstreamnt  +downstreamnt
atgatctcaaagactgacaagaacgcggtgcgtaagaaacgacatgcccacgttcgtcgt
acgatcacaggaactgctgaacgtcctcgtctaaatgttttccgttctaataagcacatt
tatgcacagttgatcgatgatgtggccggcgccactctagctagtgcttcaagcttagat
aaggaacttaacattgaaaacggtggaaacaaacaagcagctcaacaagtgggcgaactc
gttgcaaaacgtgcccttgaaaaaggtcatgaaacagtagtgtttgatcgtggcggttac
ctctaccacggtcgtgtacaagaacttgcagatgctgctcgtgaagcaggtctcaagttt
taa

DBGET integrated database retrieval system