Staphylococcus lugdunensis N920143: SLUG_16710 Help Entry SLUG_16710        CDS       T01951                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism sln  Staphylococcus lugdunensis N920143 Pathway sln01100   Metabolic pathways sln01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sln00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     SLUG_16710 (acpP)    00074 Mycolic acid biosynthesis     SLUG_16710 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     SLUG_16710 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 PP-binding_2 Ribosomal_L50 Ribosomal_L12_N HLH Motif Other DBs NCBI-ProteinID:  CCB54162 LinkDB All DBs Position complement(1761822..1762055) Genome browser AA seq 77 aa AA seqDB search MENFDKVKDIIVDRLGVDADKVTEDASFKDDLGADSLDIAELVMELEDEFGTEIPDEEAE KINTVGDAVKYINSLEK NT seq 234 nt NT seq  +upstreamnt  +downstreamnt gtggaaaacttcgacaaagtaaaggatatcatcgttgaccgtttaggtgtagatgctgat aaagtaacagaagacgcatcttttaaagatgatttaggcgctgactcacttgatatcgct gaattagtaatggaattagaagacgaatttggtactgaaattccagatgaagaagcagaa aaaatcaacactgttggtgatgctgttaaatatattaacagtcttgaaaaataa

DBGET integrated database retrieval system