Shewanella loihica: Shew_0471 Help Entry Shew_0471         CDS       T00489                                  Name (GenBank) chaperonin Cpn10   KO K04078   chaperonin GroES Organism slo  Shewanella loihica Brite KEGG Orthology (KO) [BR:slo00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:slo03110]     Shew_0471    03029 Mitochondrial biogenesis [BR:slo03029]     Shew_0471 Chaperones and folding catalysts [BR:slo03110]  Heat shock proteins   HSP10    Shew_0471 Mitochondrial biogenesis [BR:slo03029]  Mitochondrial protein import machinery   Matrix    Other matrix factors     Shew_0471 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cpn10 Motif Other DBs NCBI-ProteinID:  ABO22343 UniProt:  A3QA45 LinkDB All DBs Position 529106..529396 Genome browser AA seq 96 aa AA seqDB search MNIRPLHDRVIVKRSEVESKSAGGIVLTGSAAEQSTRGEVLAVGNGRILENGTVQPLDVK VGDIVIFNEGYGVKKEKIDGQEVLILSESDLMAVVE NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atgaatattcgtccattacatgaccgcgtcattgttaagcgttctgaagttgaatcaaaa tcagccggtggcatcgtactaacaggtagtgcagccgagcagtcaactcgcggtgaagtt cttgcagtaggcaatggccgaattcttgaaaatggcactgtgcaaccactggacgtgaaa gtgggtgacatagtgatcttcaacgaaggttacggcgtgaagaaagagaagatcgacggc caagaggtgttgatcctgtctgaatcagatttaatggctgtagtggaataa

DBGET integrated database retrieval system