Shewanella loihica: Shew_1327 Help Entry Shew_1327         CDS       T00489                                  Name (GenBank) conserved hypothetical protein   KO K02078   acyl carrier protein Organism slo  Shewanella loihica Pathway slo01100   Metabolic pathways slo01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:slo00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Shew_1327    00074 Mycolic acid biosynthesis     Shew_1327   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Shew_1327 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  ABO23196 UniProt:  A3QCJ8 LinkDB All DBs Position complement(1539077..1539310) Genome browser AA seq 77 aa AA seqDB search MNKQEFLNALEEILELDENTLKGDEVLMDIEQWDSLAFLSIIAMADEHFDIVIQGDKLEE INTVGDLVGLVEEHLAA NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgaacaaacaagaatttttaaatgccctagaagagatccttgaactggacgagaatacg cttaagggggacgaggtcttgatggacattgagcaatgggactctttggcatttctaagc atcatcgccatggccgatgagcacttcgatatagtgattcaaggtgacaagttagaagag atcaacacagtgggcgatcttgtcggtttagtagaagaacatctagccgcctaa

DBGET integrated database retrieval system