Shewanella loihica: Shew_3511 Help Entry Shew_3511         CDS       T00489                                  Name (GenBank) acyl carrier protein, putative   KO K02078   acyl carrier protein Organism slo  Shewanella loihica Pathway slo01100   Metabolic pathways slo01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:slo00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Shew_3511    00074 Mycolic acid biosynthesis     Shew_3511   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Shew_3511 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  ABO25377 UniProt:  A3QIS9 LinkDB All DBs Position 4198649..4198903 Genome browser AA seq 84 aa AA seqDB search MSLQNEIKQLIIDCLDLEDVSIDDIDTDAPLFGDGLGLDSIDALELGLAIKKQFDVKIEA NSEATKAHFYSVASLASFIESQRG NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgagcttacaaaacgaaattaaacaactcatcatagattgcctggatctcgaagatgtc agcatcgacgacatcgacacagatgcgccgctctttggcgacggtctgggactggactct atcgatgcacttgagctgggactggccatcaagaagcagttcgatgtcaaaatcgaagcc aactcggaagccaccaaggcccatttctacagtgttgccagcctggcaagctttatcgaa tctcaacgcggttag

DBGET integrated database retrieval system