Streptomyces longhuiensis: LGI35_15990 Help Entry LGI35_15990       CDS       T09038                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism slon  Streptomyces longhuiensis Pathway slon00998   Biosynthesis of various antibiotics slon01100   Metabolic pathways slon01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:slon00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     LGI35_15990    00074 Mycolic acid biosynthesis     LGI35_15990   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     LGI35_15990 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  UDL99671 LinkDB All DBs Position 3425055..3425303 Genome browser AA seq 82 aa AA seqDB search MAATQEEIVAGLAEIVNEIAGIPVEDVQLDKSFTDDLDVDSLSMVEVVVAAEERFDVKIP DDDVKNLKTVGDATDYIVKHQA NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atggccgccactcaggaagagatcgtcgccggtctcgcggagatcgtgaacgagatcgcc ggcatcccggtcgaggacgtccagctggacaagtccttcaccgacgacctggacgtcgac tcgctgtccatggtcgaggtcgtcgtcgccgccgaagagcgcttcgacgtcaagatcccg gacgacgacgtcaagaacctcaagaccgtcggtgacgccaccgactacatcgtcaagcac caggcctga

DBGET integrated database retrieval system