Streptomyces longhuiensis: LGI35_28660 Help Entry LGI35_28660       CDS       T09038                                  Name (GenBank) mycoredoxin   KO K18917   mycoredoxin [EC:1.20.4.3] Organism slon  Streptomyces longhuiensis Brite KEGG Orthology (KO) [BR:slon00001]  09190 Not Included in Pathway or Brite   09191 Unclassified: metabolism    99980 Enzymes with EC numbers     LGI35_28660 Enzymes [BR:slon01000]  1. Oxidoreductases   1.20  Acting on phosphorus or arsenic in donors    1.20.4  With disulfide as acceptor     1.20.4.3  mycoredoxin      LGI35_28660 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin Thioredoxin Thioredoxin_2 Glrx-like GST_N_2 GST_N_3 Motif Other DBs NCBI-ProteinID:  UDM01957 LinkDB All DBs Position complement(6197154..6197417) Genome browser AA seq 87 aa AA seqDB search MPGTVTMYSTTWCGYCRRLKGQMDREGIEYNEVNIEHDPDSAAFVEKANGGNQTVPTVQI VPANGGAEVVMTNPSLAQVKQALAGAA NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atgccggggactgtgacgatgtacagcacgacgtggtgcggctactgccgtcggctgaag ggccagatggaccgcgagggcatcgagtacaacgaggtcaacatcgagcacgacccggat tcggcggcgttcgtcgagaaggcgaacggcggaaaccagacggttccgacggttcagatc gttccggcgaacggtggggctgaggtcgtcatgacgaacccgagccttgcgcaggtcaag caggcgctcgccggcgccgcctga

DBGET integrated database retrieval system