Streptomyces lincolnensis: SLINC_3356 Help Entry SLINC_3356        CDS       T04801                                  Name (GenBank) DNA-binding protein HU 1   KO K03530   DNA-binding protein HU-beta Organism sls  Streptomyces lincolnensis Brite KEGG Orthology (KO) [BR:sls00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:sls03032]     SLINC_3356    03036 Chromosome and associated proteins [BR:sls03036]     SLINC_3356    03400 DNA repair and recombination proteins [BR:sls03400]     SLINC_3356 DNA replication proteins [BR:sls03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     SLINC_3356 Chromosome and associated proteins [BR:sls03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     SLINC_3356 DNA repair and recombination proteins [BR:sls03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       SLINC_3356 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding Urease_beta HU-HIG Motif Other DBs NCBI-ProteinID:  ANS65580 UniProt:  A0A1B1MAC2 LinkDB All DBs Position complement(3980978..3981259) Genome browser AA seq 93 aa AA seqDB search MNRSELVAALADRAEVTRKDADAVLAAFAETVGEIVAKGDEKVTIPGFLTFERTHRAART ARNPQTGDPIQIPAGYSVKVSAGSKLKEAAKGK NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atgaaccgcagtgagctggtggccgcgctggccgaccgcgccgaggtgacccgcaaggac gccgacgccgttctggccgcgttcgccgagaccgtcggcgagatcgtcgccaagggcgac gagaaggtcaccatccccggcttcctgaccttcgagcgcacccaccgtgccgctcgcacc gcgcgcaacccgcagaccggcgacccgatccagatcccggccggctacagcgtcaaggtc tccgcgggcagcaagctcaaggaagccgccaagggcaagtaa

DBGET integrated database retrieval system