Sideroxydans lithotrophicus: Slit_0354 Help Entry Slit_0354         CDS       T01196                                  Name (GenBank) conserved hypothetical protein   KO K02078   acyl carrier protein Organism slt  Sideroxydans lithotrophicus Pathway slt01100   Metabolic pathways slt01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:slt00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Slit_0354    00074 Mycolic acid biosynthesis     Slit_0354   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Slit_0354 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  ADE10596 UniProt:  D5CLK8 LinkDB All DBs Position 367735..367998 Genome browser AA seq 87 aa AA seqDB search MAASAQEKELAQLIVTSLNLEVSADQIEPEAPLYGEGLGLDSIDILELSLAISKTYGVQL KSDDADNSKIFSSLRNLNDHIQQHRAK NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atggcagcaagtgcacaagaaaaagagttggcacaactcatcgttacctcactcaatctc gaggtctccgcagaccagatcgaaccggaagctccgctatatggcgaaggcctggggctg gactccatcgacatcctcgaactgtcgctggcgatctccaagacctacggcgtgcaactc aagtccgacgatgcggacaacagcaagatattcagttcgctgcgcaatctgaacgaccac atccagcaacatcgcgccaaatga

DBGET integrated database retrieval system