Sideroxydans lithotrophicus: Slit_0355 Help Entry Slit_0355         CDS       T01196                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism slt  Sideroxydans lithotrophicus Pathway slt01100   Metabolic pathways slt01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:slt00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Slit_0355    00074 Mycolic acid biosynthesis     Slit_0355   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Slit_0355 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  ADE10597 UniProt:  D5CLK9 LinkDB All DBs Position 368036..368308 Genome browser AA seq 90 aa AA seqDB search MNDNDIAFRTELKALILAAVDKDEPAGGLRDDEPWFGPESRLELDSLDALQISMAIQKRY GVRMPDSKDTRRALTSLLALAEHLHKHRSS NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgaacgataacgacatcgcctttcgcaccgaactcaaggcactcattcttgccgcggta gacaaggatgagcccgccggcggcctgcgcgacgacgaaccgtggttcggtcccgaatcc aggctggaactcgattcgctggatgcgctgcagatatccatggcgatccagaagaggtac ggtgtgcgcatgccggacagcaaagacacgcgccgtgcgctgacctcgctgctggcgctg gccgaacacctgcataaacaccggtcatcatga

DBGET integrated database retrieval system