Sideroxydans lithotrophicus: Slit_1149 Help Entry Slit_1149         CDS       T01196                                  Name (GenBank) cyd operon protein YbgT   KO K00424   cytochrome bd-I ubiquinol oxidase subunit X [EC:7.1.1.7] Organism slt  Sideroxydans lithotrophicus Pathway slt00190   Oxidative phosphorylation slt01100   Metabolic pathways slt02020   Two-component system Module slt_M00153   Cytochrome bd ubiquinol oxidase Brite KEGG Orthology (KO) [BR:slt00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     Slit_1149  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     Slit_1149 Enzymes [BR:slt01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.7  quinol oxidase (electrogenic, proton-motive force generating)      Slit_1149 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  YbgT_YccB Motif Other DBs NCBI-ProteinID:  ADE11387 UniProt:  D5CR01 LinkDB All DBs Position complement(1129672..1129791) Genome browser AA seq 39 aa AA seqDB search MWYFAWILGVSMAILLAIVNTMMCDAQACVTKEESSDKE NT seq 120 nt NT seq  +upstreamnt  +downstreamnt atgtggtatttcgcctggatactgggagtctcgatggccattctgctggccatcgtcaac accatgatgtgcgacgcgcaagcttgcgtcaccaaggaagaatcaagcgacaaggaatga

DBGET integrated database retrieval system