Streptomyces luteireticuli: AB8735_04550 Help Entry AB8735_04550      CDS       T11183                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism slua  Streptomyces luteireticuli Pathway slua00998   Biosynthesis of various antibiotics slua01100   Metabolic pathways slua01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:slua00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     AB8735_04550    00074 Mycolic acid biosynthesis     AB8735_04550   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     AB8735_04550 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding ACP_SdgA_C Cas_Cas02710 Motif Other DBs NCBI-ProteinID:  XEZ38715 LinkDB All DBs Position complement(1073772..1074029) Genome browser AA seq 85 aa AA seqDB search MNTNSTTVDLEHLRTTIAEVLELDPEEVTDDARYVEDLGVDSLLALEMQIALEEQYGVQL TEADLGEATSLRATYDLVMRKTMAG NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgaacaccaacagcaccaccgtcgacctcgagcacctgcgcaccaccatcgccgaggtc ctcgaactcgaccccgaggaggtcacggacgacgcccgctatgtcgaggacctcggcgtc gactccctgctggccctggagatgcagatcgccctggaggagcagtacggcgtccagctc acggaggcggacctgggcgaggcgacgtccttgcgggcgacgtacgacctcgtcatgcgg aagaccatggcgggctga

DBGET integrated database retrieval system