Streptomyces luteireticuli: AB8735_04825 Help Entry AB8735_04825      CDS       T11183                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism slua  Streptomyces luteireticuli Pathway slua00998   Biosynthesis of various antibiotics slua01100   Metabolic pathways slua01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:slua00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     AB8735_04825    00074 Mycolic acid biosynthesis     AB8735_04825   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     AB8735_04825 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  XEZ38766 LinkDB All DBs Position 1138498..1138734 Genome browser AA seq 78 aa AA seqDB search MSTTYDQLVGIVNTLHDAPAELIAPGATFAQLDVDSLTLVEISMRIERDLGVTIEDNELQ EDLTLDATARLIDSKLAQ NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcaccacctacgaccaactggtcggcatcgtgaacacgttgcacgacgccccggcc gaactgatcgccccgggggcgaccttcgcacagctggacgtcgactcgctcaccctggtg gagatcagcatgcgcatcgagcgcgatctcggcgtcaccatcgaggacaacgagcttcag gaggacctcactcttgacgcgacggcccggctgatcgactccaagctcgcccagtaa

DBGET integrated database retrieval system