Streptomyces luteireticuli: AB8735_13480 Help Entry AB8735_13480      CDS       T11183                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism slua  Streptomyces luteireticuli Pathway slua00998   Biosynthesis of various antibiotics slua01100   Metabolic pathways slua01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:slua00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     AB8735_13480    00074 Mycolic acid biosynthesis     AB8735_13480   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     AB8735_13480 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  XEZ40356 LinkDB All DBs Position 3080700..3080948 Genome browser AA seq 82 aa AA seqDB search MAATQEEILKGLAEIVNEIAGIPVEDVQLDKSFTDDLDVDSLSMVEVVVAAEERFDVKIP DEDVKNLKTVGDAASYILKHQG NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atggccgccacgcaggaagagatcctcaagggcctcgccgagatcgtcaacgagatcgcc ggcatcccggtcgaggacgtccagctggacaagtccttcaccgacgacctggacgtcgac tccctgtccatggtcgaggtcgtcgtcgccgccgaggagcgcttcgacgtcaagatcccg gacgaggacgtcaagaacctgaagacggtcggcgacgccgcgtcctacatcctcaagcac cagggctga

DBGET integrated database retrieval system