Streptomyces luteireticuli: AB8735_33230 Help Entry AB8735_33230      CDS       T11183                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism slua  Streptomyces luteireticuli Pathway slua00998   Biosynthesis of various antibiotics slua01100   Metabolic pathways slua01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:slua00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     AB8735_33230    00074 Mycolic acid biosynthesis     AB8735_33230   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     AB8735_33230 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  XEZ44734 LinkDB All DBs Position 7413007..7413264 Genome browser AA seq 85 aa AA seqDB search MLRAVLGEYGGVDDAEITMGTRFHDDLDLESIDLVTLGGHLQARYGERVNFAEYLAALGL EEIIGLTIGQLVEHIAGCLRDPGER NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgctccgcgccgtcctcggcgagtacggcggtgtggacgacgcggagatcaccatgggg acccggttccacgacgacctggacctggagagcatcgacctggtcaccctcggcgggcac ctccaggcgcggtacggggagcgggtgaacttcgccgagtacctggccgcactcgggctg gaggagatcatcggcctgacgatcggacagctcgtcgagcacatcgccggctgcctccgc gaccccggggagcggtga

DBGET integrated database retrieval system