Sander lucioperca (pikeperch): 116039910 Help Entry 116039910         CDS       T07345                                  Name (RefSeq) claudin-4-like   KO K06087   claudin Organism sluc  Sander lucioperca (pikeperch) Pathway sluc03272   Virion - Hepatitis viruses sluc04382   Cornified envelope formation sluc04514   Cell adhesion molecule (CAM) interaction sluc04530   Tight junction Brite KEGG Orthology (KO) [BR:sluc00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03272 Virion - Hepatitis viruses     116039910  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecule (CAM) interaction     116039910  09140 Cellular Processes   09144 Cellular community - eukaryotes    04530 Tight junction     116039910  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     116039910  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:sluc03037]     116039910    04147 Exosome [BR:sluc04147]     116039910 Cilium and associated proteins [BR:sluc03037]  Other cilia and associated proteins   Stereociliary proteins    116039910 Exosome [BR:sluc04147]  Exosomal proteins   Exosomal proteins of ovarian cancer cells    116039910   Exosomal proteins of colorectal cancer cells    116039910 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PMP22_Claudin Claudin_2 DUF2232 Amastin Motif Other DBs NCBI-GeneID:  116039910 NCBI-ProteinID:  XP_031140912 LinkDB All DBs Position 5:33658655..33660356 Genome browser AA seq 162 aa AA seqDB search MWSVTDFIGCGIVETLIIWEDLWMNCVVPRTGQMQCKVYDSMLTLPQDLQVARALTISSI LLAILAVLIGITGAKCTNCIDDEASKAKVMIISGVFFIVSGVMQLIPVSWAANTIIRDFN SPLITDAQRRELGASLYIGWGAAGLLVLGGGMLCCSCPPRET NT seq 489 nt NT seq  +upstreamnt  +downstreamnt atgtggagtgtgacagacttcatcggctgcggcattgtggagactctgatcatctgggag gacctgtggatgaattgcgtggtcccgagaacgggccagatgcagtgtaaggtctatgac tccatgctcacactcccccaagacctccaagttgcccgcgccctcaccattagctccatc ctgttagccatcctagcagtactcatcggcatcactggggccaagtgcacaaactgcatt gacgacgaggcatccaaggccaaggtgatgatcatctctggggtcttcttcattgtttct ggggtcatgcagctcattcctgtctcttgggcggccaacaccattatcagggacttcaac agccctttaattactgacgctcagaggagggagctgggggcctcactgtacatcggctgg ggagctgctggcctcctggttctcggtggcggaatgctctgctgctcctgtccgccacgt gagacctga

DBGET integrated database retrieval system