Sander lucioperca (pikeperch): 116040543 Help Entry 116040543         CDS       T07345                                  Name (RefSeq) interleukin-8-like   KO K10030   interleukin 8 Organism sluc  Sander lucioperca (pikeperch) Pathway sluc04060   Cytokine-cytokine receptor interaction sluc04218   Cellular senescence sluc04620   Toll-like receptor signaling pathway sluc04621   NOD-like receptor signaling pathway sluc04622   RIG-I-like receptor signaling pathway sluc05132   Salmonella infection Brite KEGG Orthology (KO) [BR:sluc00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     116040543  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     116040543  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     116040543    04621 NOD-like receptor signaling pathway     116040543    04622 RIG-I-like receptor signaling pathway     116040543  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     116040543  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:sluc04052]     116040543    00536 Glycosaminoglycan binding proteins [BR:sluc00536]     116040543 Cytokines and neuropeptides [BR:sluc04052]  Cytokines   Chemokines    116040543 Glycosaminoglycan binding proteins [BR:sluc00536]  Heparan sulfate / Heparin   Chemokines    116040543 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  116040543 NCBI-ProteinID:  XP_031141861 Ensembl:  ENSSLUG00000024221 UniProt:  A0A8D0AM82 LinkDB All DBs Position 4:complement(45442373..45443741) Genome browser AA seq 99 aa AA seqDB search MMISRVLVASIVVLLAFLAVSEGMSLRSLGVELHCRCIQTESKPIGRHIEKVELIPANSH CDETEIIATLKKTGQEVCLDPEAPWVKKVINKIMSNRRR NT seq 300 nt NT seq  +upstreamnt  +downstreamnt atgatgatcagcagagtccttgtcgcctctattgtggtgctcctggccttcctggccgtc agtgaagggatgagtctgagaagcctgggagtggagctgcactgccgctgcatccagaca gagagcaaacccatcggccgccacatcgagaaggtggaattgattcctgccaactctcat tgcgacgagactgagatcattgccactctgaaaaagacaggccaagaagtttgcctggac cctgaagctccctgggtgaagaaagtgattaataagatcatgtccaacagaagacgctga

DBGET integrated database retrieval system