Sander lucioperca (pikeperch): 116045055 Help Entry 116045055         CDS       T07345                                  Symbol rras Name (RefSeq) ras-related protein R-Ras   KO K07830   Ras-related protein R-Ras2 Organism sluc  Sander lucioperca (pikeperch) Pathway sluc04010   MAPK signaling pathway sluc04137   Mitophagy - animal sluc04140   Autophagy - animal sluc04218   Cellular senescence sluc04371   Apelin signaling pathway sluc04625   C-type lectin receptor signaling pathway sluc04810   Regulation of actin cytoskeleton Brite KEGG Orthology (KO) [BR:sluc00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     116045055 (rras)    04371 Apelin signaling pathway     116045055 (rras)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     116045055 (rras)    04137 Mitophagy - animal     116045055 (rras)   09143 Cell growth and death    04218 Cellular senescence     116045055 (rras)   09142 Cell motility    04810 Regulation of actin cytoskeleton     116045055 (rras)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     116045055 (rras)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:sluc04147]     116045055 (rras)    04031 GTP-binding proteins [BR:sluc04031]     116045055 (rras) Exosome [BR:sluc04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    116045055 (rras)   Exosomal proteins of bladder cancer cells    116045055 (rras) GTP-binding proteins [BR:sluc04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     116045055 (rras) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU ATP_bind_1 MMR_HSR1 Motif Other DBs NCBI-GeneID:  116045055 NCBI-ProteinID:  XP_031148441 Ensembl:  ENSSLUG00000012961 UniProt:  A0A8C9YR11 LinkDB All DBs Position 2:complement(22298778..22320176) Genome browser AA seq 197 aa AA seqDB search MSGEAERFKLVVVGGGGVGKSALTIQFIQSYFVSDYDPTIEDSYTKICTVDGKETRLDIL DTAGQEEFGAMREQYMRSGEGFLLVFALNDLGSYHEVQKFHTQILRVKDRDDFPMVLVGN KADLEQQRVISREEAQAFTREHRIHYMEASAKNRYNVDESFFELVKIIRRFQEIESPPPQ SHHSGKQKRGGCPCVLL NT seq 594 nt NT seq  +upstreamnt  +downstreamnt atgagtggagaagcggaacgattcaaactggtggtggtgggaggaggaggggtggggaag agcgccctgaccatccagttcatccagtcctactttgtgtcggactacgaccccaccatc gaagactcctacactaagatctgcactgtggatggaaaggagacccggctggacattttg gatacagcaggtcaggaggagttcggggcgatgagggagcagtacatgcgctcaggagaa ggcttcttattggtgttcgcactcaacgacctgggcagctaccacgaggtccagaagttc cacactcagatcctgagagtgaaggaccgagacgacttccccatggtgctggttggaaac aaggccgacctggaacagcaaagagtgatctccagggaggaagctcaggcgttcaccaga gagcaccggatccactacatggaggcctcggccaagaatcgctacaacgtggatgaatcc ttctttgagctagtgaaaatcatcagacgattccaggagatagagagtcctcctcctcaa agtcatcactcagggaaacagaagcgcggcggctgtccctgtgtcctcctctga

DBGET integrated database retrieval system