Sander lucioperca (pikeperch): 116047321 Help Entry 116047321         CDS       T07345                                  Symbol s100a10a Name (RefSeq) protein S100-A10a   KO K17274   protein S100-A10 Organism sluc  Sander lucioperca (pikeperch) Pathway sluc04382   Cornified envelope formation sluc05132   Salmonella infection Brite KEGG Orthology (KO) [BR:sluc00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     116047321 (s100a10a)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     116047321 (s100a10a)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:sluc04147]     116047321 (s100a10a) Exosome [BR:sluc04147]  Exosomal proteins   Exosomal proteins of microglial cells    116047321 (s100a10a) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  S_100 EF-hand_1 EF-hand_7 EF-hand_5 EF-hand_6 EF-hand_8 SPARC_Ca_bdg EH MCM4_WHD NNH2 Motif Other DBs NCBI-GeneID:  116047321 NCBI-ProteinID:  XP_031151900 Ensembl:  ENSSLUG00000012898 LinkDB All DBs Position 16:complement(13519741..13521792) Genome browser AA seq 100 aa AA seqDB search MPSELETAMESLIKVFHRYASKDSRSGTLSRRELRELMENELSNFLKSQKDPAAVDKIMK DLDTNGDGQVDFEEFVSLVVGLSIACEQCYQMHMKKMGKK NT seq 303 nt NT seq  +upstreamnt  +downstreamnt atgccttcagaactggagacagccatggagtcacttatcaaggtgttccaccggtacgcc tctaaggacagtcggagcggcacactcagccggcgagagcttagagagttgatggagaac gagctgtctaacttcctcaagtctcagaaggaccctgccgctgtagacaaaatcatgaag gacttggacaccaacggtgatggccaggtggactttgaggagtttgtttctctggttgtt ggactttccattgcctgtgagcagtgctatcagatgcacatgaagaagatggggaagaag taa

DBGET integrated database retrieval system