KEGG   Sander lucioperca (pikeperch): 116049358
Entry
116049358         CDS       T07345                                 
Name
(RefSeq) FXYD domain-containing ion transport regulator 6-like
  KO
K13363  FXYD domain-containing ion transport regulator 6
Organism
sluc  Sander lucioperca (pikeperch)
Brite
KEGG Orthology (KO) [BR:sluc00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sluc02000]
    116049358
Transporters [BR:sluc02000]
 Other transporters
  Pores ion channels [TC:1]
   116049358
SSDB
Motif
Pfam: ATP1G1_PLM_MAT8 DUF2729
Other DBs
NCBI-GeneID: 116049358
NCBI-ProteinID: XP_031154782
LinkDB
Position
10:complement(28836314..28845161)
AA seq 79 aa
MDLVVLVAFSSWLAPALGSAFGRVVVASVADEEEKDYDSAFHYDYESLRIGGLVFAVVLF
FMGIALIVTRKCTCSRSDK
NT seq 240 nt   +upstreamnt  +downstreamnt
atggatcttgtggtgttggtggcgttcagctcctggctggctcctgcactcgggtcagcg
tttggcagggtggtggtagcctcagtggcagatgaagaggagaaagactatgacagtgct
tttcattatgactatgaatcgctgagaatcggtggcctggtattcgcagtggtgctgttc
ttcatgggcatcgctctcattgtcacccgaaaatgtacctgttcgaggagtgacaagtaa

DBGET integrated database retrieval system