Sander lucioperca (pikeperch): 116049679 Help Entry 116049679         CDS       T07345                                  Symbol atg12 Name (RefSeq) ubiquitin-like protein ATG12   KO K08336   ubiquitin-like protein ATG12 Organism sluc  Sander lucioperca (pikeperch) Pathway sluc04068   FoxO signaling pathway sluc04136   Autophagy - other sluc04140   Autophagy - animal sluc04621   NOD-like receptor signaling pathway sluc04622   RIG-I-like receptor signaling pathway Brite KEGG Orthology (KO) [BR:sluc00001]  09130 Environmental Information Processing   09132 Signal transduction    04068 FoxO signaling pathway     116049679 (atg12)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     116049679 (atg12)    04136 Autophagy - other     116049679 (atg12)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     116049679 (atg12)    04622 RIG-I-like receptor signaling pathway     116049679 (atg12)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:sluc04131]     116049679 (atg12)    04121 Ubiquitin system [BR:sluc04121]     116049679 (atg12)    03029 Mitochondrial biogenesis [BR:sluc03029]     116049679 (atg12) Membrane trafficking [BR:sluc04131]  Autophagy   Autophagosome formation proteins    Atg12 conjugation proteins     116049679 (atg12) Ubiquitin system [BR:sluc04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitin-like proteins (UBLs)    116049679 (atg12) Mitochondrial biogenesis [BR:sluc03029]  Mitochondrial quality control factors   Mitophagy factors    Autophagy-related proteins     116049679 (atg12) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  APG12 ATG8 Motif Other DBs NCBI-GeneID:  116049679 NCBI-ProteinID:  XP_031155434 Ensembl:  ENSSLUG00000017229 UniProt:  A0A8C9ZFZ2 LinkDB All DBs Position 10:24630895..24633952 Genome browser AA seq 117 aa AA seqDB search MSDNAESPIETQKEESQPLSDDATTNDDKKKIDVLLKAVGDTPIMKTKKWAVDRGRTVQS LSQFISRFLKLDSSEQLFIYVNQSFAPSPDQEVGVLFDSFGSDGKLVLYYCKSQAWG NT seq 354 nt NT seq  +upstreamnt  +downstreamnt atgtctgacaatgcagaatcgccaatagaaacgcaaaaagaggaatcacaaccgctgtca gacgacgcgacgacaaatgatgataagaaaaaaattgatgttctgctgaaggcagtggga gacactcctataatgaaaacaaagaagtgggcagtggacagggggaggacggtacagtcc ctttctcagttcatctctcgcttcctcaagcttgacagcagtgaacaactgttcatttat gttaaccagtcttttgccccctcaccggatcaagaagtaggggtcctctttgattctttt ggcagtgatggcaagctggttctatattactgtaaatctcaagcctggggttga

DBGET integrated database retrieval system