Sander lucioperca (pikeperch): 116053019 Help Entry 116053019         CDS       T07345                                  Symbol mt2 Name (RefSeq) metallothionein-2   KO K14739   metallothionein 1/2 Organism sluc  Sander lucioperca (pikeperch) Brite KEGG Orthology (KO) [BR:sluc00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:sluc03019]     116053019 (mt2)    03029 Mitochondrial biogenesis [BR:sluc03029]     116053019 (mt2) Messenger RNA biogenesis [BR:sluc03019]  Eukaryotic type   mRNA surveillance and transport factors    Factors involved in mRNA localization     Factors that have mRNA localization signals      116053019 (mt2) Mitochondrial biogenesis [BR:sluc03029]  Mitochondrial quality control factors   Regulator of mitochondrial biogenesis    Nuclear respiratory factors     116053019 (mt2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Metallothio Motif Other DBs NCBI-GeneID:  116053019 NCBI-ProteinID:  XP_031159727 LinkDB All DBs Position 7:complement(24560003..24561151) Genome browser AA seq 60 aa AA seqDB search MDPCDCSKSGTCNCGGSCTCTNCSCTTCKKSCCPCCPSGCTKCASGCVCKGKTCDTACCQ NT seq 183 nt NT seq  +upstreamnt  +downstreamnt atggatccttgcgactgctccaagagtggaacctgcaactgcggaggatcctgtacttgc acaaactgctcctgcaccacctgcaagaagagctgctgcccatgctgcccatccggctgc accaaatgcgcctctggatgtgtttgcaaagggaaaacttgtgacaccgcctgctgccag tga

DBGET integrated database retrieval system