Sander lucioperca (pikeperch): 116062325 Help Entry 116062325         CDS       T07345                                  Symbol kras Name (RefSeq) GTPase KRas isoform X2   KO K07827   GTPase KRas Organism sluc  Sander lucioperca (pikeperch) Pathway sluc04010   MAPK signaling pathway sluc04012   ErbB signaling pathway sluc04068   FoxO signaling pathway sluc04137   Mitophagy - animal sluc04140   Autophagy - animal sluc04150   mTOR signaling pathway sluc04210   Apoptosis sluc04218   Cellular senescence sluc04370   VEGF signaling pathway sluc04371   Apelin signaling pathway sluc04540   Gap junction sluc04625   C-type lectin receptor signaling pathway sluc04810   Regulation of actin cytoskeleton sluc04910   Insulin signaling pathway sluc04912   GnRH signaling pathway sluc04914   Progesterone-mediated oocyte maturation sluc04916   Melanogenesis Brite KEGG Orthology (KO) [BR:sluc00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     116062325 (kras)    04012 ErbB signaling pathway     116062325 (kras)    04370 VEGF signaling pathway     116062325 (kras)    04371 Apelin signaling pathway     116062325 (kras)    04068 FoxO signaling pathway     116062325 (kras)    04150 mTOR signaling pathway     116062325 (kras)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     116062325 (kras)    04137 Mitophagy - animal     116062325 (kras)   09143 Cell growth and death    04210 Apoptosis     116062325 (kras)    04218 Cellular senescence     116062325 (kras)   09144 Cellular community - eukaryotes    04540 Gap junction     116062325 (kras)   09142 Cell motility    04810 Regulation of actin cytoskeleton     116062325 (kras)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     116062325 (kras)   09152 Endocrine system    04910 Insulin signaling pathway     116062325 (kras)    04912 GnRH signaling pathway     116062325 (kras)    04914 Progesterone-mediated oocyte maturation     116062325 (kras)    04916 Melanogenesis     116062325 (kras)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:sluc04131]     116062325 (kras)   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:sluc04031]     116062325 (kras) Membrane trafficking [BR:sluc04131]  Endocytosis   Macropinocytosis    Ras GTPases     116062325 (kras) GTP-binding proteins [BR:sluc04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     116062325 (kras) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase MeaB FeoB_N ATP_bind_1 G1_gp67_C Septin NPR1_interact Motif Other DBs NCBI-GeneID:  116062325 NCBI-ProteinID:  XP_031172854 Ensembl:  ENSSLUG00000022895 LinkDB All DBs Position 7:16555156..16567692 Genome browser AA seq 188 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDL PSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHKEKMSKEGKKKKKK SKTKCTLM NT seq 567 nt NT seq  +upstreamnt  +downstreamnt atgacagaatataagttggtagtggtgggagctggtggcgttggcaagagcgcacttacg attcagctcatccagaatcactttgtggatgaatatgaccccaccatcgaggactcctac agaaagcaggtagtaatcgacggagagacgtgtctgctggacatcctggacactgcaggt caggaggagtacagtgccatgagggatcagtacatgaggactggggagggcttcctctgt gtctttgccatcaacaacaccaagtccttcgaggacattcaccactatagagaacagatt aagcgagtgaaggactctgaggacgtccccatggtgctggtggggaacaagtgtgacctc ccgtcccggacagtggacaccaagcaggctcaggatttagcacgcagctacggcattccc tttatcgagacctcagccaaaaccagacagggtgttgatgatgccttttacacattagtg cgagaaatccggaagcataaggagaagatgagcaaggagggcaaaaagaagaaaaagaag tccaagacaaagtgtacacttatgtga

DBGET integrated database retrieval system