Sander lucioperca (pikeperch): 116067300 Help Entry 116067300         CDS       T07345                                  Symbol pole3 Name (RefSeq) DNA polymerase epsilon subunit 3   KO K02326   DNA polymerase epsilon subunit 3 [EC:2.7.7.7] Organism sluc  Sander lucioperca (pikeperch) Pathway sluc03030   DNA replication sluc03082   ATP-dependent chromatin remodeling sluc03410   Base excision repair sluc03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:sluc00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     116067300 (pole3)    03410 Base excision repair     116067300 (pole3)    03420 Nucleotide excision repair     116067300 (pole3)   09126 Chromosome    03082 ATP-dependent chromatin remodeling     116067300 (pole3)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:sluc03032]     116067300 (pole3)    03036 Chromosome and associated proteins [BR:sluc03036]     116067300 (pole3)    03400 DNA repair and recombination proteins [BR:sluc03400]     116067300 (pole3) Enzymes [BR:sluc01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.7  Nucleotidyltransferases     2.7.7.7  DNA-directed DNA polymerase      116067300 (pole3) DNA replication proteins [BR:sluc03032]  Eukaryotic type   DNA Replication Elongation Factors    DNA polymerase epsilon complex     116067300 (pole3) Chromosome and associated proteins [BR:sluc03036]  Eukaryotic type   Chromatin remodeling factors    CHRAC complex     116067300 (pole3) DNA repair and recombination proteins [BR:sluc03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Long Patch-BER factors      DNA polymerase epsilon complex       116067300 (pole3) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CBFD_NFYB_HMF Histone CENP-T_C CIS_TMP SpoU_methylase RNA_pol_3_Rpc31 DUF5427 DUF3276 DUF4746 CDC45 Motif Other DBs NCBI-GeneID:  116067300 NCBI-ProteinID:  XP_031179577 Ensembl:  ENSSLUG00000009195 UniProt:  A0A8D0CW23 LinkDB All DBs Position 3:complement(37186013..37193476) Genome browser AA seq 149 aa AA seqDB search MAERPEDLNLPNAVITRIIKEALPDGVNVSKEARRAISQAASVFVLYATSCANNFALKAK RKTLNAGDVLAAMEEMEFERFLEPLREALEVYKKGQKGKKEVSEQKRKDKEKKPDSENEK SREEEEEEEERMEEEPEAENDAEDEEVEN NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atggcggagagacccgaagatctgaacctgcccaacgcggtgatcacccgcatcatcaag gaggcgctcccagatggggtgaacgtgtcgaaagaagcaaggagagccatatcccaagct gccagcgtgtttgtgttgtatgcaacgtcctgtgcaaacaactttgccttgaaagccaaa cggaaaactctgaacgcaggagacgttttggctgcgatggaggaaatggagtttgagcga ttcctggagccgctcagagaagctctggaagtgtacaagaagggccagaaaggaaagaag gaggtgtcggagcagaaacgtaaagacaaagagaagaagccggactctgagaacgagaag agccgggaggaggaagaggaggaggaggagcgcatggaggaggagcccgaagccgagaac gacgccgaggacgaggaggtggagaactga

DBGET integrated database retrieval system