Saccharomycodes ludwigii: SCDLUD_002953 Help Entry SCDLUD_002953     CDS       T08289                                  Name (RefSeq) hypothetical protein   KO K03009   DNA-directed RNA polymerases I, II, and III subunit RPABC4 Organism slud  Saccharomycodes ludwigii Pathway slud03020   RNA polymerase slud03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:slud00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     SCDLUD_002953   09124 Replication and repair    03420 Nucleotide excision repair     SCDLUD_002953  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:slud03021]     SCDLUD_002953    03400 DNA repair and recombination proteins [BR:slud03400]     SCDLUD_002953 Transcription machinery [BR:slud03021]  Eukaryotic type   RNA polymerase II system    RNA polymerase II     Pol I, II, III common subunits      SCDLUD_002953   RNA polymerase III system    RNA polymerase III      SCDLUD_002953   RNA polymerase I system    RNA polymerase I      SCDLUD_002953 DNA repair and recombination proteins [BR:slud03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase II complex       SCDLUD_002953 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DNA_RNApol_7kD DZR_2 DZR HypA MCM_OB DUF5816 Zn_ribbon_SprT zinc-ribbons_6 zinc-ribbon_6 Motif Other DBs NCBI-GeneID:  70108270 NCBI-ProteinID:  XP_045935391 LinkDB All DBs Position III:1583462..1583674 Genome browser AA seq 70 aa AA seqDB search MSREGFQIPTNLDAAATGSAQTRQATLKYICAECSSKLSLSKTDPVRCKDCGHRILLKAR TKRMVQFEAR NT seq 213 nt NT seq  +upstreamnt  +downstreamnt atgtccagagaaggtttccagattccaacaaacttagatgctgctgctactggtagtgct caaactagacaagccactttaaaatatatttgtgctgaatgttccagtaagttatcatta agcaaaacagatccagttcgttgtaaagattgcggtcatagaattctattaaaggctaga acaaagagaatggtgcaatttgaggctcgttaa

DBGET integrated database retrieval system