Saccharomycodes ludwigii: SCDLUD_003009 Help Entry SCDLUD_003009     CDS       T08289                                  Name (RefSeq) hypothetical protein   KO K00730   dolichyl-diphosphooligosaccharide---protein glycosyltransferase subunit 4 Organism slud  Saccharomycodes ludwigii Pathway slud00510   N-Glycan biosynthesis slud00513   Various types of N-glycan biosynthesis slud01100   Metabolic pathways slud04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:slud00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     SCDLUD_003009    00513 Various types of N-glycan biosynthesis     SCDLUD_003009  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     SCDLUD_003009 SSDB OrthologParalogGFIT Motif Pfam:  Ost4 Motif Other DBs NCBI-GeneID:  70108326 NCBI-ProteinID:  XP_045935446 LinkDB All DBs Position III:complement(<1716407..>1716571) Genome browser AA seq 54 aa AA seqDB search MITDNQLNAMAIIFGISMFVLIVLYGAIQLNTTPDKQEPNEKEEYFAEKDELLE NT seq 165 nt NT seq  +upstreamnt  +downstreamnt atgattacagataaccaattaaatgctatggctataatattcggtattagtatgtttgtt ttaatcgtactatatggagcaattcaactgaatacgactccagacaaacaagaaccaaat gaaaaagaagagtattttgccgagaaagacgaattgctggaataa

DBGET integrated database retrieval system