KEGG   Streptomyces luomodiensis: PS467_29205
Entry
PS467_29205       CDS       T10277                                 
Symbol
coaD
Name
(GenBank) pantetheine-phosphate adenylyltransferase
  KO
K00954  pantetheine-phosphate adenylyltransferase [EC:2.7.7.3]
Organism
sluo  Streptomyces luomodiensis
Pathway
sluo00770  Pantothenate and CoA biosynthesis
sluo01100  Metabolic pathways
sluo01240  Biosynthesis of cofactors
Module
sluo_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:sluo00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    PS467_29205 (coaD)
Enzymes [BR:sluo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.3  pantetheine-phosphate adenylyltransferase
     PS467_29205 (coaD)
SSDB
Motif
Pfam: CTP_transf_like Citrate_ly_lig HcgB
Other DBs
NCBI-ProteinID: WNE99113
UniProt: A0ABY9V2Y9
LinkDB
Position
6896780..6897289
AA seq 169 aa
MTGPESEELPLRRAVCPGSFDPVTNGHLDIIARASKLYDVVHVAVMINKSKQGLFTVEER
MDLLRKTTEEYGNVQVESFHGLLVDFCKQRDIPAIVKGLRAVSDFDYELQMAQMNNGLSG
VETLFVPTNPTYSFLSSSLVKEVAAWGGDVSHLVPPVVLEALSERLGRK
NT seq 510 nt   +upstreamnt  +downstreamnt
atgaccggacccgagagcgaggaacttccgttgcgccgcgcagtctgtccggggtcgttc
gaccccgtcaccaatggacacctcgacatcatcgcccgtgcctccaagctctatgacgtc
gtgcacgtcgccgtgatgatcaacaagtccaagcagggcctgttcacggtggaggagcgg
atggacctcctccgcaagaccaccgaggagtacggaaacgttcaggtggagtccttccac
gggctcctcgtcgacttctgcaagcagcgggacatccccgcgatcgtcaaggggctgcgg
gccgtcagcgacttcgactacgagctccagatggcccagatgaacaacggcctctccggc
gtggagacgctgttcgtgcccaccaaccccacctacagcttcctgtcctccagcctggtc
aaggaggtcgcggcctggggcggtgacgtctcccacctggtgcccccggtggtcctggag
gccctctccgagcggctcggcaggaagtag

DBGET integrated database retrieval system