Streptomyces luomodiensis: PS467_29205
Help
Entry
PS467_29205 CDS
T10277
Symbol
coaD
Name
(GenBank) pantetheine-phosphate adenylyltransferase
KO
K00954
pantetheine-phosphate adenylyltransferase [EC:
2.7.7.3
]
Organism
sluo Streptomyces luomodiensis
Pathway
sluo00770
Pantothenate and CoA biosynthesis
sluo01100
Metabolic pathways
sluo01240
Biosynthesis of cofactors
Module
sluo_M00120
Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:
sluo00001
]
09100 Metabolism
09108 Metabolism of cofactors and vitamins
00770 Pantothenate and CoA biosynthesis
PS467_29205 (coaD)
Enzymes [BR:
sluo01000
]
2. Transferases
2.7 Transferring phosphorus-containing groups
2.7.7 Nucleotidyltransferases
2.7.7.3 pantetheine-phosphate adenylyltransferase
PS467_29205 (coaD)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
CTP_transf_like
Citrate_ly_lig
HcgB
Motif
Other DBs
NCBI-ProteinID:
WNE99113
UniProt:
A0ABY9V2Y9
LinkDB
All DBs
Position
6896780..6897289
Genome browser
AA seq
169 aa
AA seq
DB search
MTGPESEELPLRRAVCPGSFDPVTNGHLDIIARASKLYDVVHVAVMINKSKQGLFTVEER
MDLLRKTTEEYGNVQVESFHGLLVDFCKQRDIPAIVKGLRAVSDFDYELQMAQMNNGLSG
VETLFVPTNPTYSFLSSSLVKEVAAWGGDVSHLVPPVVLEALSERLGRK
NT seq
510 nt
NT seq
+upstream
nt +downstream
nt
atgaccggacccgagagcgaggaacttccgttgcgccgcgcagtctgtccggggtcgttc
gaccccgtcaccaatggacacctcgacatcatcgcccgtgcctccaagctctatgacgtc
gtgcacgtcgccgtgatgatcaacaagtccaagcagggcctgttcacggtggaggagcgg
atggacctcctccgcaagaccaccgaggagtacggaaacgttcaggtggagtccttccac
gggctcctcgtcgacttctgcaagcagcgggacatccccgcgatcgtcaaggggctgcgg
gccgtcagcgacttcgactacgagctccagatggcccagatgaacaacggcctctccggc
gtggagacgctgttcgtgcccaccaaccccacctacagcttcctgtcctccagcctggtc
aaggaggtcgcggcctggggcggtgacgtctcccacctggtgcccccggtggtcctggag
gccctctccgagcggctcggcaggaagtag
DBGET
integrated database retrieval system