Sphingomonas lutea: H9L13_04205 Help Entry H9L13_04205       CDS       T06880                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism slut  Sphingomonas lutea Pathway slut01100   Metabolic pathways slut01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:slut00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     H9L13_04205    00074 Mycolic acid biosynthesis     H9L13_04205   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     H9L13_04205 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  QNN68527 UniProt:  A0A7G9SL02 LinkDB All DBs Position complement(806316..806558) Genome browser AA seq 80 aa AA seqDB search MSDRQQTLAKVLEMIAPFNKKGVDVGEATRFAQDLEWDSLTVLDFVANIEDEFDVIISMN MQAEIETVGQLVDALGKLKA NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgtccgaccgccagcagaccctcgccaaagtcctcgagatgatcgcgccgttcaacaag aagggcgtcgacgtcggcgaggcgacgcgcttcgcccaggatcttgaatgggacagcctc accgtgctcgattttgtcgccaatatcgaagacgaattcgacgtgatcatctccatgaac atgcaggccgagatcgaaaccgtcggccagctggtcgacgcgctggggaagttgaaggcg taa

DBGET integrated database retrieval system