KEGG   Streptomyces lividans: SLIV_09135
Entry
SLIV_09135        CDS       T03222                                 
Name
(GenBank) thioesterase
  KO
K21791  thioesterase
Organism
slv  Streptomyces lividans
Pathway
slv00333  Prodigiosin biosynthesis
slv01100  Metabolic pathways
slv01110  Biosynthesis of secondary metabolites
Module
slv_M00838  Undecylprodigiosin biosynthesis, L-proline => undecylprodigiosin
Brite
KEGG Orthology (KO) [BR:slv00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    SLIV_09135
SSDB
Motif
Pfam: Thioesterase Abhydrolase_6 Hydrolase_4 Abhydrolase_3 Lipase_3
Other DBs
NCBI-ProteinID: AIJ12832
LinkDB
Position
complement(2087646..2088488)
AA seq 280 aa
MSPADLLSQRSAWFPRPVAAPAAEPPDPAAAPLRLVCFPYAGGTVSAFRGWQERLGDEVA
VVPVQLPGRGLRLRERPYDTMEPLAEAVADALEEHRLTHDYALFGHSMGALLAYEVACVL
RRRGAPRPRHLFVSGSRAPHLYGDRADHTLSDTALREVIRDLGGLDDADTLGAAYFDRRL
PVLRADLRACERYDWHPRPPLDCPTTAFSAAADPIATPEMVEAWRPYTTGSFLRRHLPGN
HFFLNGGPSRDRLLAHLGTELDALGTTPHRKATREATWTF
NT seq 843 nt   +upstreamnt  +downstreamnt
atgtcgcccgctgacctgctctcccagcgttccgcctggttcccccgccccgtcgcggca
ccggccgccgagccgcccgacccggcggccgccccgctgcgcctggtctgcttcccctac
gccggggggacggtctccgcgttccgcggctggcaggagcggctgggcgacgaggtcgcc
gtcgtacccgtacaactgcccggccgcggactgcgcctgcgcgagcggccgtacgacacc
atggaacccctcgccgaagcggtcgcggacgcgctggaggagcaccggctcacccacgac
tacgccctgttcgggcacagcatgggcgccctgctcgcctacgaggtggcctgcgtgctg
cgccggcgcggggcaccgcggccccggcacctgttcgtctccggcagccgggccccgcac
ctgtacggcgaccgcgccgaccacaccctgtccgacaccgccctgcgcgaggtcatccgg
gacctgggcggcctcgacgacgcggacaccctgggcgccgcctacttcgaccgcagactc
ccggtgctccgcgccgacctgcgcgcctgcgagcgctacgactggcacccccggccaccg
ctggactgcccgacgaccgcgttctccgccgccgccgaccccatcgccaccccggagatg
gtcgaggcctggcggccctacaccaccggctcgttcctgcggcgccacctgccgggcaac
cacttcttcctgaacggcggcccgtcccgcgaccggctgctcgcccacctgggcaccgaa
ctcgacgccctcggcaccaccccgcacaggaaggcaactagggaagcaacatggacattc
tga

DBGET integrated database retrieval system