KEGG   Streptomyces lividans: SLIV_09195
Entry
SLIV_09195        CDS       T03222                                 
Name
(GenBank) RedV protein
  KO
K21785  4-hydroxy-2,2'-bipyrrole-5-methanol dehydrogenase
Organism
slv  Streptomyces lividans
Pathway
slv00333  Prodigiosin biosynthesis
slv01100  Metabolic pathways
slv01110  Biosynthesis of secondary metabolites
Module
slv_M00838  Undecylprodigiosin biosynthesis, L-proline => undecylprodigiosin
Brite
KEGG Orthology (KO) [BR:slv00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    SLIV_09195
SSDB
Motif
Pfam: Nitroreductase
Other DBs
NCBI-ProteinID: AIJ12844
LinkDB
Position
2105646..2106833
AA seq 395 aa
MTTRRTDHMAAAVSPFAQALETAAGAAALSPSSHNCQPWGLGRATSTTARRVAADLTGAD
ADEYLVLALDRERELTALAAHAVEMEVSCGVYWQILLRTLAAQGWTTAAVRVLDGDADPG
AAGLPGGGRPFGAGWPTAWTPLCVVALRPGPLSGERPADLHESALARRTHRGPYGREPVA
PGLLRDLEEPATPGATAHPVHLRHLTERRDLRAFAAFVARHAGRDFGHRAAWRETHSFVR
RDTADATARGDGFTLEQLFGPMSRPRRAAMRLALAPTTMHLLGKVGYHRVLAAGLADVVR
RTPAVVTMGFAGQAPTRAEQLEGGARLADYWWRATRHGLSLHPISIVLQHDDLRGRLERE
LSLPGRTFFVSRVGVAGSPAPRSHRRADAAVHVSF
NT seq 1188 nt   +upstreamnt  +downstreamnt
atgacgacccgcaggacagaccacatggccgcggccgtgtccccgttcgcccaggcgctg
gagacggcggccggggcggcggcgctgagtccctcctcccacaactgccagccgtggggc
ctgggccgtgccacgagcaccacggcccgccgggtggcggcggacctgaccggcgcggac
gcggacgagtacctggtcctggccctcgaccgcgagcgggagctgacggcgctggccgcg
cacgcggtggagatggaggtcagctgcggcgtctactggcagatcctgctccgcacgctg
gcggcccagggctggacgacggcggcggtgcgcgtcctggacggcgacgcggaccccggc
gcggcggggctgcccggcggcggccgcccgttcggtgccggatggccgacggcgtggacg
ccgctgtgcgtggtggcgctgcgccccgggccgctctccggagaacggccggccgacctg
cacgagagcgccctcgcccgccgcacccaccgcggcccctacgggcgggagccggtggcc
cccgggctgctgcgcgacctggaggagcccgccacacccggagccacggcacacccggtc
cacctccggcacctgaccgagcggcgcgacctgcgggcgttcgcggcgttcgtcgcccgg
cacgcgggacgcgacttcgggcaccgggccgcctggcgggagacccactccttcgtccgc
cgggacaccgcggacgcgaccgcgcggggcgacgggttcacgctggagcagctcttcggg
cccatgtcccggccgcgccgggcggcgatgcgcctcgcgctggccccgacgacgatgcac
ctgctgggcaaggtcggctaccaccgggtgctggccgccggtctcgccgacgtcgtgcgc
cgcactccggccgtggtgaccatgggcttcgccgggcaggcgcccacacgggcggagcag
ctcgaaggcggggcgcgactggccgactactggtggcgggcgacccgccacggcctgtcc
ctgcaccccatcagcatcgtcctccagcacgacgacctgcgcggccggctggagcgggaa
ctctccctgcccggccgcaccttcttcgtgagccgggtcggtgtggccggctcgcccgcg
ccgcgctcccaccggcgcgcggacgccgccgtgcacgtgtccttctga

DBGET integrated database retrieval system