Streptomyces lividans: SLIV_12445 Help Entry SLIV_12445        CDS       T03222                                  Name (GenBank) glutaredoxin-like protein   KO K18917   mycoredoxin [EC:1.20.4.3] Organism slv  Streptomyces lividans Brite KEGG Orthology (KO) [BR:slv00001]  09190 Not Included in Pathway or Brite   09191 Unclassified: metabolism    99980 Enzymes with EC numbers     SLIV_12445 Enzymes [BR:slv01000]  1. Oxidoreductases   1.20  Acting on phosphorus or arsenic in donors    1.20.4  With disulfide as acceptor     1.20.4.3  mycoredoxin      SLIV_12445 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin Thioredoxin_2 GST_N_2 GST_N_3 Thioredoxin Glrx-like Motif Other DBs NCBI-ProteinID:  AIJ13480 UniProt:  D6EW05 LinkDB All DBs Position 2851512..2851754 Genome browser AA seq 80 aa AA seqDB search MSGTVTMYSTTWCGYCRRLKSQMDREGIAYTEVNIEQDPESAAFVEKANGGNQTVPTVLF PDGSTLTNPSLAQVKQKIGA NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgtcgggcactgtgacgatgtacagcaccacctggtgcggctactgccgtcggctgaag agccagatggaccgcgagggcatcgcgtacaccgaggtcaacatcgagcaggacccggag tccgccgcgttcgtggagaaggcgaatggcggaaaccagacggtgcccaccgtgctcttc cccgacggctccactctgacgaacccgtcgctggcgcaggtcaagcagaagatcggcgcg taa

DBGET integrated database retrieval system