KEGG   Streptomyces lividans: SLIV_13270
Entry
SLIV_13270        CDS       T03222                                 
Name
(GenBank) secreted protein
  KO
K14628  enoyl reductase
Organism
slv  Streptomyces lividans
Pathway
slv01057  Biosynthesis of type II polyketide products
slv01100  Metabolic pathways
slv01110  Biosynthesis of secondary metabolites
Module
slv_M00779  Dihydrokalafungin biosynthesis, octaketide => dihydrokalafungin
Brite
KEGG Orthology (KO) [BR:slv00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01057 Biosynthesis of type II polyketide products
    SLIV_13270
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:slv01008]
    SLIV_13270
Polyketide biosynthesis proteins [BR:slv01008]
 Polyketide tailoring proteins
  Others
   SLIV_13270
SSDB
Motif
Pfam: Cytotoxic
Other DBs
NCBI-ProteinID: AIJ13642
LinkDB
Position
complement(3038112..3039143)
AA seq 343 aa
MPAVSKSLRCATVAAIVLVSVISAPMAFAGGRGEGGSRGSTDQQANADGNGTVSVTVGGV
VFDRSKNGSGDSVGAVTSSTSWSPPACWYAPKYTPEELQDYLEPIWEAESTGYEWDAKQR
EKYNAKDEKKGFNKDKTGKGFWWGSYVNESFPPGWDKCDTDYFWVDTGDPPPADKENAVT
PEVLAELAYAEIRVPGTEVTLAPAEATKVNLPTWAWLDGAEFKPVSVTASVKEIGIEATA
TAEPVSLQIKPGTPDAETYPASGVCEIKNGRIGAPYEKGRADDAPPCGVKYLRSSGDGTF
PLQATVTWEIHWTGTGGAGGDLPDGTFGATQDVVVQEIQAVNR
NT seq 1032 nt   +upstreamnt  +downstreamnt
atgccagccgtaagtaaatctttgaggtgtgcgaccgtagccgcgatcgttctcgtctcg
gtgatatcggccccgatggccttcgcgggcgggcgaggcgagggcggcagtcgcggctcc
acggatcaacaagccaacgccgacggtaatggcaccgtttcagtcacggtaggcggtgtc
gtcttcgaccgttcgaagaacgggagcggcgattcggtcggtgcggtgacgtcgtccacc
tcctggagcccgccggcgtgctggtacgccccgaagtacacgcccgaggagttgcaggat
tacctggaacccatctgggaggccgagtccacggggtacgagtgggatgccaagcagcgg
gagaagtacaacgcgaaggatgagaagaagggcttcaacaaggacaagacgggcaagggc
ttctggtggggctcgtacgtgaacgagagcttcccgcccggctgggacaagtgcgacacg
gactatttctgggtggacacgggtgacccgccgcccgcggacaaggagaacgcggtcacc
ccggaggtcctcgccgaactcgcctacgcggagatccgcgtccccgggaccgaggtgacg
ctggcgcccgccgaggcgaccaaggtgaaccttccgacgtgggcgtggctggacggtgcc
gagttcaagccggtctcggtcaccgcgtccgtgaaggagatcggcatcgaggcgacggcc
acggccgagccggtctcgctgcagatcaagccgggcaccccggacgccgagacctacccg
gcgtcgggagtctgcgagatcaagaacggccgtatcggcgctccctacgagaagggcagg
gcggacgacgcacctccgtgcggcgtgaagtacctgcgttcctcgggcgacggcacgttt
ccgctccaggcgacggtcacgtgggagatccactggaccggaaccggcggcgcgggcggc
gaccttcccgacggtacgttcggcgccacccaggacgtcgtcgtccaggagatccaggcc
gtcaaccggtga

DBGET integrated database retrieval system