Streptomyces lividans: SLIV_25755 Help Entry SLIV_25755        CDS       T03222                                  Name (GenBank) hypothetical protein   KO K02078   acyl carrier protein Organism slv  Streptomyces lividans Pathway slv00998   Biosynthesis of various antibiotics slv01100   Metabolic pathways slv01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:slv00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     SLIV_25755    00074 Mycolic acid biosynthesis     SLIV_25755   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     SLIV_25755 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 EAL Motif Other DBs NCBI-ProteinID:  AIJ16063 UniProt:  A0ABM5R7H7 LinkDB All DBs Position complement(5772004..5772252) Genome browser AA seq 82 aa AA seqDB search MAATQEEIVAGLAEIVNEIAGIPVEDVKLDKSFTDDLDVDSLSMVEVVVAAEERFDVKIP DDDVKNLKTVGDATKYILDHQA NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atggccgccactcaggaagagatcgtcgccggtctcgcggagatcgtgaacgagatcgcc ggcatcccggtcgaggacgtcaagctggacaagtccttcaccgacgacctggacgtcgac tcgctgtccatggtcgaggtcgtcgtcgccgccgaagagcgcttcgacgtcaagatcccg gacgacgacgtcaagaacctcaagacggtcggcgacgcgacgaagtacatcctcgaccac caggcctga

DBGET integrated database retrieval system