Streptomyces lividans: SLIV_31430 Help Entry SLIV_31430        CDS       T03222                                  Name (GenBank) acyl carrier protein   KO K05553   minimal PKS acyl carrier protein Organism slv  Streptomyces lividans Pathway slv00253   Tetracycline biosynthesis slv01056   Biosynthesis of type II polyketide backbone slv01100   Metabolic pathways slv01110   Biosynthesis of secondary metabolites Module slv_M00778   Type II polyketide backbone biosynthesis, acyl-CoA + malonyl-CoA => polyketide Brite KEGG Orthology (KO) [BR:slv00001]  09100 Metabolism   09109 Metabolism of terpenoids and polyketides    01056 Biosynthesis of type II polyketide backbone     SLIV_31430    00253 Tetracycline biosynthesis     SLIV_31430  09180 Brite Hierarchies   09181 Protein families: metabolism    01004 Lipid biosynthesis proteins [BR:slv01004]     SLIV_31430    01008 Polyketide biosynthesis proteins [BR:slv01008]     SLIV_31430 Lipid biosynthesis proteins [BR:slv01004]  Polyketide synthase   Component type    SLIV_31430 Polyketide biosynthesis proteins [BR:slv01008]  Polyketide synthase (PKS)   Type II PKS    C7-C14 cyclized polyketide type     Octaketide PKS      SLIV_31430     Nonaketide PKS      SLIV_31430     Decaketide PKS      SLIV_31430 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Ribosomal_L50 PP-binding_2 DUF7080 Motif Other DBs NCBI-ProteinID:  AIJ17174 UniProt:  D6ES84 LinkDB All DBs Position 6997920..6998192 Genome browser AA seq 90 aa AA seqDB search MSPFTLEDLTAMVAEIAGAEAARALSEQPADAPFTSLGFDSMAVIELAERIQERYGVPIP DEAVHDLRTVRRTLDYVNGRAAVAAADGAR NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgtcccctttcaccctggaagacctgacggcgatggtggccgagatcgccggcgccgaa gcggcccgggcgctctcggagcagccggccgacgcgcccttcacgtcgttggggttcgac tcgatggccgtcatcgaactggccgagcggatccaggagcgctacggcgttcccatcccg gacgaggcggtgcacgacctgcgcaccgtccggcggaccctcgactacgtgaacggcagg gcagccgtcgccgcggcggacggagcccgctga

DBGET integrated database retrieval system