Streptomyces lividans: SLIV_31455 Help Entry SLIV_31455        CDS       T03222                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism slv  Streptomyces lividans Pathway slv00998   Biosynthesis of various antibiotics slv01100   Metabolic pathways slv01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:slv00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     SLIV_31455    00074 Mycolic acid biosynthesis     SLIV_31455   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     SLIV_31455 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AIJ17179 LinkDB All DBs Position 7002372..7002629 Genome browser AA seq 85 aa AA seqDB search MTTDTTPHSRAYDLLASVLCNKFEVPSEAIVPTATFEQLDLDSLAVVELFVVLTEELGIE VQDGEADPDLTLAGVADLIAEAVKP NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgaccaccgacaccacgccccacagccgcgcatacgacctgctcgcctcggttctctgc aacaagttcgaagtgccctccgaggccatcgtccccaccgcgaccttcgagcagctggac ctcgactcgctggccgtggtggagctgttcgtcgtactcaccgaggaactcggcatcgaa gtgcaggacggcgaggccgacccggacctcaccctggccggcgtggccgacctcatcgcc gaggccgtcaagccgtga

DBGET integrated database retrieval system