Parathermosynechococcus lividus: BRW62_00320
Help
Entry
BRW62_00320 CDS
T05303
Name
(GenBank) 50S ribosomal protein L18
KO
K02881
large subunit ribosomal protein L18
Organism
slw
Parathermosynechococcus lividus
Pathway
slw03010
Ribosome
Brite
KEGG Orthology (KO) [BR:
slw00001
]
09120 Genetic Information Processing
09122 Translation
03010 Ribosome
BRW62_00320
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03011 Ribosome [BR:
slw03011
]
BRW62_00320
Ribosome [BR:
slw03011
]
Ribosomal proteins
Mitochondria/ Chloroplast
Large subunit
BRW62_00320
Bacteria
BRW62_00320
Archaea
BRW62_00320
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Ribosomal_L18p
Motif
Other DBs
NCBI-ProteinID:
ATS17445
UniProt:
A0A2D2PYX5
LinkDB
All DBs
Position
complement(58632..58994)
Genome browser
AA seq
120 aa
AA seq
DB search
MKKTRTAARQSRHQRIRRKVKGTGDRPRLAVFRSHQHIYAQVIDDSRHHTLVAASSVEPS
LRQKLGNGSNCAASAEVGRLIAERAKAAGIQQVVFDRGGNIYHGRVKALADAAREAGLDF
NT seq
363 nt
NT seq
+upstream
nt +downstream
nt
atgaagaaaactcgtactgccgctcgtcaaagtcggcatcagcgcattcgtcgcaaagtc
aaaggcaccggcgatcgcccccgtctcgctgttttccgttcccaccagcacatctatgcc
caagtcattgacgacagccggcatcatacccttgtcgccgcctccagtgttgagccgtca
ctgcgacaaaagctgggaaatggcagcaactgtgccgcctctgctgaagttgggcggctg
attgctgagcgtgccaaggccgctggcatccagcaagtcgtctttgatcgcggcggaaat
atctatcacggtcgcgtcaaagcccttgcggatgctgcccgtgaagccggactggacttt
tag
DBGET
integrated database retrieval system